PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do021900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MYB
Protein Properties Length: 265aa    MW: 28918.1 Da    PI: 4.9343
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do021900.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.13.5e-122483148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT............TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg............kgRtlkqcksrwqkyl 48
                     +g W++eEde+l   ++ +   tW+++a+  g            ++R++k+c++rw +yl
       Do021900.1 24 KGLWSPEEDERLFAQIAYHSVSTWSSVAQLAGkldsfqsdlvlrLRRSGKSCRLRWMNYL 83
                     678*******************************************************97 PP

2Myb_DNA-binding46.68.1e-1591132346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + ++ E+e+++ + + lG++ W+tIa++m+ gRt++++k++w++
       Do021900.1  91 PISKREEEIIISLQQSLGNR-WSTIAARMP-GRTDNEIKNYWNS 132
                      56889***************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.3431983IPR017930Myb domain
SuperFamilySSF466891.8E-2423130IPR009057Homeodomain-like
SMARTSM007174.0E-82385IPR001005SANT/Myb domain
PfamPF002491.7E-102483IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.2E-192590IPR009057Homeodomain-like
CDDcd001671.09E-62783No hitNo description
PROSITE profilePS5129422.05184138IPR017930Myb domain
SMARTSM007172.1E-1388136IPR001005SANT/Myb domain
CDDcd001673.31E-1091131No hitNo description
Gene3DG3DSA:1.10.10.605.0E-2491138IPR009057Homeodomain-like
PfamPF002492.8E-1291132IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MVRKPSHGDS GAGDLSTEAN KERKGLWSPE EDERLFAQIA YHSVSTWSSV AQLAGKLDSF  60
QSDLVLRLRR SGKSCRLRWM NYLRPDLKKE PISKREEEII ISLQQSLGNR WSTIAARMPG  120
RTDNEIKNYW NSRIRKRLNA AAKPDGASAE PVPAAEAKVE PTNEATETAS ISTIPARFPV  180
FACQLLDELV GGGGISSAGG GGSGESTPST TSTQQQNSGD EREASVGDSN MIHFLSFDNL  240
DYPADLLMDV PGAMDAWESE LYPAN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-23241407110B-MYB
1h8a_C4e-232413827128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715594e-88EU971559.1 Zea mays clone 367166 anthocyanin regulatory C1 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968332.11e-127PREDICTED: transcription factor MYB82-like
TrEMBLK3XL221e-127K3XL22_SETIT; Uncharacterized protein
STRINGSi002595m1e-127(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.21e-43myb domain protein 55